Seaside, California - PDFSEARCH.IO - Document Search Engine

Seaside, California
Results: 120

#	Item
31	RESOLUTION NOA RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SEASIDE APPROVING THE REVISED TRANSPORTATION AGENCY FOR MONTEREY COUNTY (TAMC) REGIONAL DEVELOPMENT IMPACT FEES WHEREAS, the City Council of the City o Add to Reading List Source URL: www.codepublishing.com Language: English - Date: 2015-04-15 17:04:21 Monterey California Big-box store Retailing Fee Pricing
32	SectionPopulation and Housing Subsequent Environmental Impact Report Add to Reading List Source URL: seasidemontereydownsandveteranscemeteryspecificplan.com Language: English - Date: 2015-03-30 13:13:39 Monterey County California Seaside California Association of Monterey Bay Area Governments Sustainable Communities and Climate Protection Act Santa Cruz California Fort Ord Monterey Bay Geography of California Geography of the United States Monterey California
33	Little Compton Spring Photography Show at the Little Compton Community Center. Proceeds from this year’s show will be used to benefit the not-forprofit center. Located in the beautiful seaside community of Little Compt Add to Reading List Source URL: www.lccenter.com Language: English - Date: 2015-03-23 10:13:23 Geography of California Compton Little Compton Rhode Island Geography of the United States
34	ORDINANCE NO. 997 AN ORDINANCE OF THE CITY OF SEASIDE, CALIFORNIA ADOPTING THE 2010 EDITIONS OF THE CALIFORNIA BUILDING, RESIDENTIAL, PLUMBING, ELECTRICAL, MECHANICAL AND FIRE CODES, AND RELATED MODEL CODES, WITH APPENDI Add to Reading List Source URL: www.codepublishing.com Language: English - Date: 2015-04-10 19:09:17 California Building Standards Code Government of California Building engineering Legal codes International Building Code Building code Uniform Plumbing Code Plumbing code National Electrical Code Construction Plumbing Architecture
35	ORDINANCE NO. 992 AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF SEASIDE AUTHORIZING AN AMENDMENT TO THE CONTRACT BETWEEN THE CITY COUNCIL OF THE CITY OF SEASIDE AND THE BOARD OF ADMINISTRATION OF THE CALIFORNIA PUBLIC Add to Reading List Source URL: www.codepublishing.com Language: English - Date: 2015-04-10 19:08:20 United States American studies Heights Community Council State Universities Retirement System CalPERS United States Constitution Politics of the United States
36	RESOLUTION NOA RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SEASIDE ADOPTING THEINVESTMENT POLICY WHEREAS, pursuant to the provisions of Sectionof the California Government Code the City Counci Add to Reading List Source URL: www.codepublishing.com Language: English - Date: 2015-04-15 17:11:57 Financial services Collective investment schemes Funds Financial markets Mutual fund Money market fund Repurchase agreement Interest rate Market liquidity Financial economics Investment Finance
37	RESOLUTION NOA RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SEASIDE APPROVING AMENDEMENTS TO THE BY-LAWS OF THE ASSOCIATION OF MONTEREY BAY AREA GOVERNMENTS (AMBAG) WHEREAS, on September 30, 2010, AMBAG forwarde Add to Reading List Source URL: www.codepublishing.com Language: English - Date: 2015-04-15 17:15:09 Monterey County California Geography of the United States California Geography of California Association of Monterey Bay Area Governments Seaside California
38	ORDINANCE NO. 964 AN ORDINANCE OF THE CITY OF SEASIDE, CALIFORNIA, ADOPTING A COMPREHENSIVE UPDATE TO SPECIFIED CHAPTERS OF THE SEASIDE ZONING CODE AND AMENDING TITLE 17 OF THE SEASIDE MUNICIPAL CODE THE CITY COUNCIL OF Add to Reading List Source URL: www.codepublishing.com Language: English - Date: 2015-04-10 20:12:38 Zoning Law Architecture Urban studies and planning California Environmental Quality Act Setback Building code Town Zoning in the United States Real property law Real estate Land law
39	ORDINANCE NO. 961 ·AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF SEASIDE, CALIFORNIA, DESCRIBING THE Add to Reading List Source URL: www.codepublishing.com Language: English - Date: 2015-04-10 20:11:00 California Environmental Quality Act Eminent domain Urban renewal Human geography Urban geography Construction Religious Land Use and Institutionalized Persons Act Urban studies and planning Redevelopment Urban decay
40	01_GraphicsOverview_5 Add to Reading List Source URL: www.watersupplyproject.org Language: English - Date: 2014-10-03 17:35:44 Water desalination Desalination Filters Monterey California Monterey Peninsula Salinas California Seaside California Monterey County California Geography of California Geography of the United States Water supply